General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4JVS0",
        "id": "CDLS_CORJK",
        "source_organism": {
            "taxId": "306537",
            "scientificName": "Corynebacterium jeikeium (strain K411)",
            "fullName": "Corynebacterium jeikeium (strain K411)"
        },
        "name": "Cyclo(L-leucyl-L-leucyl) synthase",
        "description": [
            "It uses activated amino acids in the form of aminoacyl-tRNAs (aa-tRNAs) as substrates to catalyze the ATP-independent formation of cyclodipeptides which are intermediates in diketopiperazine (DKP) biosynthetic pathways. Catalyzes the formation of cyclo(L-Leu-L-Leu) (cLL) from L-leucyl-tRNA(Leu). Can incorporate various nonpolar residues, such as L-leucine and L-methionine, into cyclodipeptides"
        ],
        "length": 216,
        "sequence": "MGESKQEHLIVGVSPFNPRFTPEWLSSAFQWGAERFNTVDVLHPGEISMSLLTSTGTPLGRAKRKVRQQCNRDMRNVEHALEISGIKLGRGKPVLISDYLQTQSYQCRRRSVIAEFQNNQIFQDACRAMSRAACQSRLRVTNVNIEPDIETAVKYIFDELPAYTHCSDLFEYETAALGYPTEWPIGKLIESGLTSLERDPNSSFIVIDFEKELIDD",
        "proteome": "UP000000545",
        "gene": "jk0923",
        "go_terms": [
            {
                "identifier": "GO:0016755",
                "name": "aminoacyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e2559a2cccffd381d329a1521e291d505cba06e3",
        "counters": {
            "domain_architectures": 840,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 840
        }
    }
}