GET /api/protein/UniProt/Q4J8L0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4J8L0",
        "id": "HJC_SULAC",
        "source_organism": {
            "taxId": "330779",
            "scientificName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)",
            "fullName": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)"
        },
        "name": "Crossover junction endodeoxyribonuclease Hjc",
        "description": [
            "A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are ligated to produce recombinant products",
            "Redundant function with Holliday junction resolvase Hje"
        ],
        "length": 143,
        "sequence": "MSNKTKGSTLERYLVSRLRDKGFAVIRAPASGSNRKDHVPDVIAMKSGVIILIEMKSRKNGNKIYIQKEQAEGIKEFAKKSGGELFLGAKIAKDLKFLRFDELRRTEAGNYVADLETIKSGMDFDELVRYVEGKISKTLDSFM",
        "proteome": "UP000001018",
        "gene": "hjc",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f309d2b16932c4072297d236e2d8c431b0641c3d",
        "counters": {
            "domain_architectures": 1086,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1086
        }
    }
}