General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q4ICG5",
        "id": "AP2S_GIBZE",
        "source_organism": {
            "taxId": "229533",
            "scientificName": "Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)",
            "fullName": "Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus)"
        },
        "name": "AP-2 complex subunit sigma",
        "description": [
            "Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration (By similarity)"
        ],
        "length": 143,
        "sequence": "MLSFILIQNRQGKTRLAKWYAPFSDEQKIKLKGEVHRLVAPRDQKYQSNFVEFRNNKIVYRRYAGLFFCACVDTNDNELAFLEAIHFFVEVLDAFFGNVCELDLVFNFYKVYAILDEVFLAGEIEETSKQVVLTRLEHLDKLE",
        "proteome": "UP000070720",
        "gene": "APS2",
        "go_terms": [
            {
                "identifier": "GO:0035615",
                "name": "clathrin-cargo adaptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0072583",
                "name": "clathrin-dependent endocytosis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030122",
                "name": "AP-2 adaptor complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "06d32c800fac36020d03f379936b1bd62ff88561",
        "counters": {
            "domain_architectures": 27458,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27458
        }
    }
}