GET /api/protein/UniProt/Q45QI7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q45QI7",
"id": "CFI_CAMSI",
"source_organism": {
"taxId": "4442",
"scientificName": "Camellia sinensis",
"fullName": "Camellia sinensis (Tea plant)"
},
"name": "Chalcone--flavanone isomerase",
"description": [
"Catalyzes the intramolecular cyclization of bicyclic chalcones into tricyclic (S)-flavanones. Responsible for the isomerization of 4,2',4',6'-tetrahydroxychalcone (also termed chalcone) into naringenin (By similarity)"
],
"length": 230,
"sequence": "MSPSQSPSVAQVQIESHVFPPTVKPPGTSKPFFLGGAGERGLEIQGKFIKFTAIGVYLEDSAIPSLAVKWKGKTAEELTDSVDFFRDIVSGPFEKFTQVTMILPLTGQQYSEKVTENCVAYWKAVGTYTDAEAKAIEKFIEVFKDETFPPGGSILFTQSPLGSLTIAFSKDGSLPETGTVVMENKQLSEAVLESIIGKHGVSPAAKKSLAARMSELLKEKPEAQTAAAAE",
"proteome": null,
"gene": "CHI",
"go_terms": [
{
"identifier": "GO:0016872",
"name": "intramolecular lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045430",
"name": "chalcone isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009813",
"name": "flavonoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a57c2db5c9b31812072fff4965513e3df1dc8e59",
"counters": {
"domain_architectures": 2834,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2834
}
}
}