General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3ZM03",
        "id": "RSSA_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Small ribosomal subunit protein uS2",
        "description": [
            "Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis"
        ],
        "length": 306,
        "sequence": "MSGGLDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPITEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKATTKEEFQGEWTAPVAEFPQAEVADWSEGVQVPSVPIQQFTAERTDVPPAPKPTEDWSTQPASTDDWSAAPTAQASEWTGTTTEWS",
        "proteome": "UP000186698",
        "gene": "rpsa",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005055",
                "name": "laminin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a328e9e4e47b02e404d7154b306c7edeeb2dd053",
        "counters": {
            "domain_architectures": 2919,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "hamap": 2,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 2,
                "prints": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2919
        }
    }
}