HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q3ZK62",
"id": "NSP2_ROT41",
"source_organism": {
"taxId": "578843",
"scientificName": "Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14])",
"fullName": "Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14]) (RV-A)"
},
"name": "Non-structural protein 2",
"description": [
"Participates in replication and packaging of the viral genome. Plays a crucial role, together with NSP5, in the formation of virus factories (viroplasms), which are large inclusions in the host cytoplasm where replication intermediates are assembled and viral RNA replication takes place. Displays ssRNA binding, NTPase, RNA triphosphatase (RTPase) and ATP-independent helix-unwinding activities. The unwinding activity may prepare and organize plus-strand RNAs for packaging and replication by removing interfering secondary structures. The RTPase activity plays a role in the removal of the gamma-phosphate from the rotavirus RNA minus strands of dsRNA genome segments. Participates in the selective exclusion of host proteins from stress granules (SG) and P bodies (PB). Also participates in the sequestration of these remodeled organelles in viral factories"
],
"length": 317,
"sequence": "MAELACFCYPHLENDSYKFIPFNSLAIKCMLTAKVDKKDQDKFYNSIIYGIAPPPQFKKRYNTNDNSRGMNYETSMFNKVAVLICEALNSIKVTQSDVANVLSKVVSVRHLENLVLRRENHQDVLFHSRDLLLKSVLIAIGHSKEIETTATAEGGEIVFQNAAFTMWKLTYLEHELMPILDQNFVEYKITVNEDKPLSESHIKELIAELRWQYNKFAVITHGKGHYRVVKYSSVANHADRVYATFKSNSKNGGMIEFNLLDQRIIWQNWYAFTSSMKQGNTLETCKKLLFQKMKRESNPFKGLSTDRKMDEVSQIGI",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0016817",
"name": "hydrolase activity, acting on acid anhydrides",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004550",
"name": "nucleoside diphosphate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0017111",
"name": "ribonucleoside triphosphate phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019079",
"name": "viral genome replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "dc37c3a5618ed52ed284a284ffa144571a76bb09",
"counters": {
"domain_architectures": 2774,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"hamap": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2774
}
}
}