General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3Z1T8",
        "id": "Q3Z1T8_SHISS",
        "source_organism": {
            "taxId": "300269",
            "scientificName": "Shigella sonnei (strain Ss046)",
            "fullName": "Shigella sonnei (strain Ss046)"
        },
        "name": "4Fe-4S ferredoxin-type domain-containing protein",
        "description": [
            "Electron transfer subunit of the terminal reductase during anaerobic growth on various sulfoxide and N-oxide compounds"
        ],
        "length": 205,
        "sequence": "MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPNIVIKPNANSRPTSDTTGYLANPEEV",
        "proteome": "UP000002529",
        "gene": "SSON_1575",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dde7e9e639ebdaa722ccfbc5a50ae15964fb967c",
        "counters": {
            "domain_architectures": 3631,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3631
        }
    }
}