GET /api/protein/UniProt/Q3T064/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q3T064",
"id": "ROP1_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "Ropporin-1",
"description": [
"Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation"
],
"length": 212,
"sequence": "MPQTDKQICIPPELPELLKQFTKAAIRSQPQDLIQWAAEYFGAMSRGEIPPVRERSERVALSNWAELTPELLKILHSRVGGRLIVQADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDSGPPRIPFSTFQFLYTYIAEVDGEISASHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE",
"proteome": "UP000009136",
"gene": "ROPN1",
"go_terms": null,
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1
}
}
}