General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3SWQ7",
        "id": "YBEY_NITWN",
        "source_organism": {
            "taxId": "323098",
            "scientificName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)",
            "fullName": "Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)"
        },
        "name": "Endoribonuclease YbeY",
        "description": [
            "Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA"
        ],
        "length": 190,
        "sequence": "MPNITCREQPARARRGGEKHIMIRSATPVTEILVVADCWRAEAGAEAVIHRAIATAAGMVDKDTGDAELAIMLTDDAGIRTLNANWRGLDKPTNVLSFPALQPTGPCLPDDPPRMLGDIAIAYETLRREAGDERKTFDHHLSHLAVHGFLHLIGYDHETDGEAEEMESLERQILAQLGIPDPYAPPERMT",
        "proteome": "UP000002531",
        "gene": "ybeY",
        "go_terms": [
            {
                "identifier": "GO:0004222",
                "name": "metalloendopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6ce7ffab98862a99814a555b2e3be9e9cdf93050",
        "counters": {
            "domain_architectures": 27024,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27024
        }
    }
}