General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3MH13",
        "id": "Q3MH13_TRIV2",
        "source_organism": {
            "taxId": "240292",
            "scientificName": "Trichormus variabilis (strain ATCC 29413 / PCC 7937)",
            "fullName": "Trichormus variabilis (strain ATCC 29413 / PCC 7937)"
        },
        "name": "Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase",
        "description": [
            "Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 272,
        "sequence": "MKTLIHPTAVIHPNSELHPTVQVGAYAVIGAHVKVGPETIIGAHAVIEGPCEIGARNQIFTGAAIGMEPQDLKFVGEPTWVKIGDNNLIREYVTINRATGAGEATIIGNNNLLMAYTHVAHNCVIEDSVVIANSVALAGHVHIESRARLSGVLGVHQFVHIGRQAMVGGMARIDRDVPPYMLVEGNPGRIRTLNLVGLKRSGMEASDLQLLKKAFRILYRSNLLFKEALEELETLGDTEYLQHLRRFLLLSQMPGRRGLIPGRGKSGGSDES",
        "proteome": null,
        "gene": "lpxA",
        "go_terms": [
            {
                "identifier": "GO:0008780",
                "name": "acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "266b33f7d362e69aba906bb4145c4dd7b1f8c2c1",
        "counters": {
            "domain_architectures": 5237,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 2,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5237
        }
    }
}