GET /api/protein/UniProt/Q3M4A8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3M4A8",
        "id": "Q3M4A8_TRIV2",
        "source_organism": {
            "taxId": "240292",
            "scientificName": "Trichormus variabilis (strain ATCC 29413 / PCC 7937)",
            "fullName": "Trichormus variabilis (strain ATCC 29413 / PCC 7937)"
        },
        "name": "Oxygen-dependent coproporphyrinogen-III oxidase",
        "description": [
            "Key enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III",
            "Involved in the heme and chlorophyll biosynthesis. Catalyzes the aerobic oxidative decarboxylation of propionate groups of rings A and B of coproporphyrinogen-III to yield the vinyl groups in protoporphyrinogen-IX"
        ],
        "length": 347,
        "sequence": "MVTNSQTPTVKAKISPSLPATDAKARVSNFMKQLQDEITQALTKLDGVGQFHEDSWERPEGGGGRSRVLRDGAIFEQAGVNFSEVWGSHLPPSILAQRPEAEGHGFYATGTSLVLHPRNPYVPTVHLNYRYFEAGPVWWFGGGADLTPYYPFAEDAAHFHQTLKGACDEHHPEYYPVFKRWCDEYFYLKHRDETRGVGGLFFDYQDGQGVLYRGPNPKGEAANYSNQVGEPAPRDWEDLFSFVQGSGKAFLPAYVPIVERRHGIEYGDRQRNFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLPPLVRWEYGYQPEPNSPEAELYDTFLKPQDWSNWTAKQ",
        "proteome": null,
        "gene": "hemF",
        "go_terms": [
            {
                "identifier": "GO:0004109",
                "name": "coproporphyrinogen oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006779",
                "name": "porphyrin-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "97f62c4bbc5df6f2ae641c578c8a1aafbda2cf84",
        "counters": {
            "domain_architectures": 16872,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 16872
        }
    }
}