HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q3LVT0",
"id": "Q3LVT0_9RETR",
"source_organism": {
"taxId": "45617",
"scientificName": "Human endogenous retrovirus K",
"fullName": "Human endogenous retrovirus K"
},
"name": "Protease",
"description": [
"Enhances the activity of the reverse transcriptase. May be part of the mature RT",
"Nucleocapsid protein p14: Nucleocapsid protein"
],
"length": 213,
"sequence": "DYKGEIQLVISSSIPWSASPGDRIAQLLLLPYIKGGNSEIKIIGGLGSTDPTGKAAYWASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPTPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVPVEAKINQKREGIGYPF",
"proteome": null,
"gene": "prt",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "4897f117fc64af1f2b3f9308b1ab4536a2697627",
"counters": {
"domain_architectures": 58,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"profile": 2,
"smart": 1,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 58
}
}
}