General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3KPV4",
        "id": "TMUB1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Transmembrane and ubiquitin-like domain-containing protein 1",
        "description": [
            "May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly"
        ],
        "length": 308,
        "sequence": "MALIEGVGDEVTVLFALVLFFMVLMLAWVSTHTTERAPTHWIRPEPAQGGASSNSQRDFHPGPSQTLTNADPNSETVDSSDSTQSSREFQNAGATPHSEVAFSSSGSTVSTGGSVEYTGAAADSPPDGESHPNFTVSSRDPQAGASSSLRYRGLGDGTTAQSAEEAGTIHLRLKFLNDTERLVTVRLSDTIMYIKRTYFPGQELRVRLIFQGQLLRDDSQTVSSLQLRDGSVLHCHISQHASVPGVGADQANVPLNVGNLLVPLLFLIVMLLWYCQFQYPSLFTGTATACLGGFTLLISAIAFSSYHR",
        "proteome": "UP000186698",
        "gene": "tmub1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036503",
                "name": "ERAD pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "24f2218322192295606dadcb11305c43283c22d2",
        "counters": {
            "domain_architectures": 32823,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32823
        }
    }
}