GET /api/protein/UniProt/Q3J7X1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3J7X1",
        "id": "Q3J7X1_NITOC",
        "source_organism": {
            "taxId": "323261",
            "scientificName": "Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)",
            "fullName": "Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)"
        },
        "name": "PqqA binding protein",
        "description": [
            "Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway"
        ],
        "length": 89,
        "sequence": "MHDNDIPAIAPLYRFQWEEAQNCYVLLYPEGMIKLNLSAGEILEHCNGKLNINAIIALLQQKYPQANLANDVREFLETAHNNGWLSTEN",
        "proteome": "UP000006838",
        "gene": "pqqD",
        "go_terms": [
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0018189",
                "name": "pyrroloquinoline quinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cf4c228ea0558b5123ee962cb98aba0737bc7305",
        "counters": {
            "domain_architectures": 11077,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11077
        }
    }
}