GET /api/protein/UniProt/Q3IHM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3IHM8",
        "id": "METAS_PSET1",
        "source_organism": {
            "taxId": "326442",
            "scientificName": "Pseudoalteromonas translucida (strain TAC 125)",
            "fullName": "Pseudoalteromonas translucida (strain TAC 125)"
        },
        "name": "Homoserine O-succinyltransferase",
        "description": [
            "Transfers a succinyl group from succinyl-CoA to L-homoserine, forming succinyl-L-homoserine"
        ],
        "length": 315,
        "sequence": "MPITVKDELPAIARLRQENVFVMPQTRAKTQEIRPMRLAILNLMPNKVETEVQFIRLLANSPLQVNVELLRLDTHRSSSNSEQHLDTFYRYFSEVKNNNYDALIVTGAPLAHLEYQDVAYWDEFTAILDWAEQHVTSTLFSCWAAHAALYHHYKIKRDLKTDKLCGVFTHQCYFEHGALTRGFDDTFLVPHSRYGHVDVNKINACNELVVLAGSEKVGAYLVKNKSGSQVFITGHPEYDADSLKAEYQRDCEKSDNAPKPENYFPDDDATKQPSKTWQSHAFLLFSNWLNYYVYQTTPYDINLVSQDVRTNNYAE",
        "proteome": "UP000006843",
        "gene": "metAS",
        "go_terms": [
            {
                "identifier": "GO:0008899",
                "name": "homoserine O-succinyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019281",
                "name": "L-methionine biosynthetic process from homoserine via O-succinyl-L-homoserine and cystathionine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a7fed6e94dfbd44cfc6501254b2649dde18f54d8",
        "counters": {
            "domain_architectures": 8981,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8981
        }
    }
}