General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q38ZK1",
        "id": "Q38ZK1_LATSS",
        "source_organism": {
            "taxId": "314315",
            "scientificName": "Latilactobacillus sakei subsp. sakei (strain 23K)",
            "fullName": "Latilactobacillus sakei subsp. sakei (strain 23K)"
        },
        "name": "Transcriptional regulatory protein WalR",
        "description": [
            "Member of the two-component regulatory system WalK/WalR that regulates genes involved in cell wall metabolism. Binds to the promoter region of the transcription factor fabT gene in the fabTH-acp operon in vitro. Inhibits transcription of fabT, probably acting in an unphosphorylated form, thereby playing a role in the regulation of fatty acid biosynthesis. Essential for normal growth in vitro. Required for maintaining normal cellular morphology, acting, at least in part, by regulating peptidoglycan hydrolase pcsB. Involved in maintaining expression of WalRK regulon genes in exponentially growing cells"
        ],
        "length": 237,
        "sequence": "MAKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVEEVVPDLILLDLMLPKVDGLEVARQVRKSHDMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELVARVKANLRRQGSTSQSDKEANEENHEINIGDLTIHPEAYIVSKRGTKIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPEWLVTRRGVGYYLRNPEQE",
        "proteome": "UP000002707",
        "gene": "LCA_0077",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000976",
                "name": "transcription cis-regulatory region binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "214263e87a1ba73528c547c1c5657a9093191d60",
        "counters": {
            "domain_architectures": 293517,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "smart": 2,
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 2,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 293517
        }
    }
}