General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q32904",
        "id": "CB23_PEA",
        "source_organism": {
            "taxId": "3888",
            "scientificName": "Pisum sativum",
            "fullName": "Pisum sativum (Garden pea)"
        },
        "name": "Chlorophyll a-b binding protein 3, chloroplastic",
        "description": [
            "The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated",
            "May channel protons produced in the catalytic Mn center of water oxidation into the thylakoid lumen"
        ],
        "length": 275,
        "sequence": "MATQALVSSSSLTFAAEAVRQSFRARSLPSSVGCSRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH",
        "proteome": null,
        "gene": "lhca3",
        "go_terms": [
            {
                "identifier": "GO:0009765",
                "name": "photosynthesis, light harvesting",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3c39b492cec2880b905b58a2a6af891ce705de4",
        "counters": {
            "domain_architectures": 20743,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 10,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 20743
        }
    }
}