General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q31UZ6",
        "id": "Q31UZ6_SHIBS",
        "source_organism": {
            "taxId": "300268",
            "scientificName": "Shigella boydii serotype 4 (strain Sb227)",
            "fullName": "Shigella boydii serotype 4 (strain Sb227)"
        },
        "name": "Lipopolysaccharide core heptose(I) kinase",
        "description": [
            "Kinase involved in the biosynthesis of the core oligosaccharide region of lipopolysaccharide (LPS). Catalyzes the phosphorylation of heptose I (HepI), the first heptose added to the Kdo2-lipid A module"
        ],
        "length": 265,
        "sequence": "MVELKEPFATLWRGKDPFEEVKTLQGEVFRELETRRTLRFEMAGKSYFLKWHRGTTLKEIIKNLLSLRMPVLGADREWSAIHRLRDVGVDTMYGVAFGEKGINPLSRTSFIITEDLTPTISLEDYCADWATNPPDVRVKRMLIKRVATMVRDMHAAGINHRDCYICHFLLHLPFSGKEEELKISVIDLHRAQLRTRVPRRWRDKDLIGLYFSSMNIGLTQRDIWRFMKVYFAAPLKDILKQEQGLLSQAEAKATKIRERTIRKSL",
        "proteome": null,
        "gene": "rfaP",
        "go_terms": [
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009103",
                "name": "lipopolysaccharide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a5aef97ef5001f4e0f71c8229f6da9cfadb22cb",
        "counters": {
            "domain_architectures": 12757,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12757
        }
    }
}