GET /api/protein/UniProt/Q316Q1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q316Q1",
"id": "COAX_OLEA2",
"source_organism": {
"taxId": "207559",
"scientificName": "Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)",
"fullName": "Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)"
},
"name": "Type III pantothenate kinase",
"description": [
"Catalyzes the phosphorylation of pantothenate (Pan), the first step in CoA biosynthesis"
],
"length": 263,
"sequence": "MPSVFLLFDIGNTNVKIGIADHDGVVASYVLPTDTHQTGDSLGLRLADVVRHAGFAPGDVTACVASSVVPSFNPLMRQACGRYFDRRLLLAPEDIAIPLENRYERPQEVGADRLVAAFAARRLWPAPRSIVSVDYGTATTFDCVQGEAYLGGLICPGVHSAAGALAAGTARLPRISLDVREDLPVVGRSTSMSLNHGFVFGFASMTEGLCHRLSAVLEAPMQVVATGGFASAIARVSNCFDHVRPDLLLEGLRILYMESGIKG",
"proteome": "UP000002710",
"gene": "coaX",
"go_terms": [
{
"identifier": "GO:0004594",
"name": "pantothenate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "34a0011a5f1d2a889fee47cd426d5028e15e7d37",
"counters": {
"domain_architectures": 17983,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17983
}
}
}