GET /api/protein/UniProt/Q30ZJ9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q30ZJ9",
"id": "CLPS_OLEA2",
"source_organism": {
"taxId": "207559",
"scientificName": "Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)",
"fullName": "Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)"
},
"name": "ATP-dependent Clp protease adapter protein ClpS",
"description": [
"Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation"
],
"length": 104,
"sequence": "MSDRKLSTREDADVLLEEELKEPRRFRVLLHNDDYTSMDFVVAVLIDIFRKSREQAMSIMLSVHEKGIGVCGVYTAEVAETKVAMVHARARAEGFPLRCSMEEV",
"proteome": "UP000002710",
"gene": "clpS",
"go_terms": [
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030163",
"name": "protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d52f623440b9fe9a889148966c03893a09b55845",
"counters": {
"domain_architectures": 19190,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19190
}
}
}