General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2YQM7",
        "id": "PDXJ_BRUA2",
        "source_organism": {
            "taxId": "359391",
            "scientificName": "Brucella abortus (strain 2308)",
            "fullName": "Brucella abortus (strain 2308)"
        },
        "name": "Pyridoxine 5'-phosphate synthase",
        "description": [
            "Catalyzes the complicated ring closure reaction between the two acyclic compounds 1-deoxy-D-xylulose-5-phosphate (DXP) and 3-amino-2-oxopropyl phosphate (1-amino-acetone-3-phosphate or AAP) to form pyridoxine 5'-phosphate (PNP) and inorganic phosphate"
        ],
        "length": 246,
        "sequence": "MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDIRALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFLAPIVARLKGRGMRVSLFADPDSLGYERAKAIGADRVELYTGPYGATHDDPAAAARELDRLEKAARAATALGLAVNAGHDLTVDNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTVSRYITALAG",
        "proteome": "UP000002719",
        "gene": "pdxJ",
        "go_terms": [
            {
                "identifier": "GO:0033856",
                "name": "pyridoxine 5'-phosphate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008615",
                "name": "pyridoxine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d30fd621cde3415e41f164eee544a43d4e949320",
        "counters": {
            "domain_architectures": 13589,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13589
        }
    }
}