GET /api/protein/UniProt/Q2SY33/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2SY33",
        "id": "Q2SY33_BURTA",
        "source_organism": {
            "taxId": "271848",
            "scientificName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)",
            "fullName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)"
        },
        "name": "phosphoglycolate phosphatase",
        "description": [
            "Specifically catalyzes the dephosphorylation of 2-phosphoglycolate. Is involved in the dissimilation of the intracellular 2-phosphoglycolate formed during the DNA repair of 3'-phosphoglycolate ends, a major class of DNA lesions induced by oxidative stress"
        ],
        "length": 241,
        "sequence": "MSSSSPSFAASQSGAPRLEACEAVLFDLDGTLADTAPDLAAAVNKMQRSRGAAPTPLDALRPLASAGARGLIGGAFGIVPADAEFDALRDEFLANYATDLCVHTTLFPGIGALLDDLDARGVRWGIVTNKAARFTDPLVALLGLAARAACVVSGDTASHPKPHPAPLLHAAQSLSLAPERIVYVGDDLRDIQAGSAAGMPTVAAAYGYCGDGVAPADWQAQHLVETTDDLQRLLRVLRYND",
        "proteome": "UP000001930",
        "gene": "gph-1",
        "go_terms": [
            {
                "identifier": "GO:0008967",
                "name": "phosphoglycolate phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7c618a5a1b4907fd1b81ed0bddc341d92e965caa",
        "counters": {
            "domain_architectures": 89113,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "sfld": 3,
                "pfam": 1,
                "ncbifam": 3,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 89113
        }
    }
}