General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2SU92",
        "id": "Q2SU92_BURTA",
        "source_organism": {
            "taxId": "271848",
            "scientificName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)",
            "fullName": "Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)"
        },
        "name": "Intermembrane phospholipid transport system permease protein MlaE",
        "description": [
            "Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. Probably responsible for the translocation of the substrate across the membrane"
        ],
        "length": 255,
        "sequence": "MISAIGRFVIGGLERTGYATRMFVRVVLEFFSLLRRPRLVTKQIHFLGNYSFVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVSALLFAGRAGTSLTAEIGLMKAGEQLTALEMMAVDPLKNVIAPRMWAGVIAMPLLAAIFSAVGVLGGYVVGVLLIGVDPGAFWSQMQGGVEVWADVGNGVIKSVVFGFAVTFIALFQGYEAKPTPEGVSHATTKTVVYASLAVLGLDFLLTALMFS",
        "proteome": "UP000001930",
        "gene": "BTH_I3003",
        "go_terms": [
            {
                "identifier": "GO:0043190",
                "name": "ATP-binding cassette (ABC) transporter complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4bcb48343b4016f894b8975eb2f0b1b5a787f2bb",
        "counters": {
            "domain_architectures": 32176,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32176
        }
    }
}