GET /api/protein/UniProt/Q2NU70/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2NU70",
        "id": "Q2NU70_SODGM",
        "source_organism": {
            "taxId": "343509",
            "scientificName": "Sodalis glossinidius (strain morsitans)",
            "fullName": "Sodalis glossinidius (strain morsitans)"
        },
        "name": "Outer membrane protein A",
        "description": [
            "With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm. Acts as a porin with low permeability that allows slow penetration of small solutes; an internal gate slows down solute passage"
        ],
        "length": 356,
        "sequence": "MKKTAIALAVALAGFATVAQAAPKDDTWYTGGKLGWSQYHDTGFYGNGFDNRIANGPTRDDQLGAGAFLGYQANPYLGFELGYDWLGRMAYKGSVNNGAFKAQGISLAAKLSYPLTDDLDIYTRLGGMVWRADSKGAYDNGNAGRVSDHDTGVSPLAAVGLEYAWTKNWATRLDYQWVNNIGDAGTVGTRPDNSMLSVGVSYRFGQDEVAPPAPAPAPVVQTKHFTLKSDVLFNFDKATLKPEGQQALDQLYSQLSSMDPKDGSVVVLGYTDRIGTEQYNQKLSQERAQSVVSYLVSKGIPSDKISARGMGKSNPVTGNTCNSVKGRAAVISCLAPDRRVEIEVKGIKDVVTQPQD",
        "proteome": "UP000001932",
        "gene": "ompA",
        "go_terms": [
            {
                "identifier": "GO:0009279",
                "name": "cell outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015288",
                "name": "porin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "88ba11a7c22d2e5b7750c9e3f2664a237e38bd34",
        "counters": {
            "domain_architectures": 3202,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3202
        }
    }
}