General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2N699",
        "id": "Q2N699_ERYLH",
        "source_organism": {
            "taxId": "314225",
            "scientificName": "Erythrobacter litoralis (strain HTCC2594)",
            "fullName": "Erythrobacter litoralis (strain HTCC2594)"
        },
        "name": "Electron transfer flavoprotein subunit alpha",
        "description": [
            "The electron transfer flavoprotein serves as a specific electron acceptor for other dehydrogenases. It transfers the electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase)"
        ],
        "length": 309,
        "sequence": "MKTLVWVEHDNNEMKDATLSAVTAASQLGEVHLLVAGSGCAGVADAAAKIAGVGKVHLADDPAYEHALAENVAPLIVDQMGHHDAFVAPATTTGKNIAPRVAALLDVMQISDILSVEGDKTFTRPIYAGNAIATVQSSDEKLVITVRGTAFDKAEAEGGSGTVEAVSGPTGEGLSQFVSQEIAESERPELTSAKVIVSGGRALKDAETFEQYITPLADKLGAGIGASRAAVDAGYVPNDYQVGQTGKIVAPEVYIAIGISGAIQHLAGMKDSKTIIAINKDEDAPIFQVADIGLVGDLYKVVPELMEKL",
        "proteome": "UP000008808",
        "gene": "ELI_13500",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "40422e0a1e864f427b9ada5b552568aa56fecfcf",
        "counters": {
            "domain_architectures": 32728,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 2,
                "pfam": 2,
                "smart": 1,
                "cathgene3d": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32728
        }
    }
}