General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2KV05",
        "id": "ARGC_BORA1",
        "source_organism": {
            "taxId": "360910",
            "scientificName": "Bordetella avium (strain 197N)",
            "fullName": "Bordetella avium (strain 197N)"
        },
        "name": "N-acetyl-gamma-glutamyl-phosphate reductase",
        "description": [
            "Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde"
        ],
        "length": 353,
        "sequence": "MAQARNSRIKVGIVGGTGYTGVELLRLLSQHPDVELTAITSRKEDGLPVAEMYPNLRGHVKLAFSAPEKASLTDCDVVFFATPHGVAMAQAQALTAAGTRVIDLAADFRLQDTASFERWYKMPHGCPDILAKQSAYGLVELNRAAIAQAQVIGNPGCYPTTVILGLAPLLERKLIDTQALIADCKSGVSGAGRKAEVASLFSEASDNFKAYGVAGHRHHPEITEQLEKLAGGKVGLTFVPHLVPMIRGMFSTIYARILPEARETDFQALFEERYAGEAFIDVMPAGSLPETRSVRASNNLRIAVQRPGNGDQLIVLVVQDNLVKGAAGQAVQNMNLMFGLPETTGLNQVAILP",
        "proteome": "UP000001977",
        "gene": "argC",
        "go_terms": [
            {
                "identifier": "GO:0016620",
                "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003942",
                "name": "N-acetyl-gamma-glutamyl-phosphate reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070401",
                "name": "NADP+ binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006526",
                "name": "L-arginine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "52bf697ab0df6821f91ae51f1c8ee7a108518ae8",
        "counters": {
            "domain_architectures": 25110,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 2,
                "smart": 1,
                "pfam": 2,
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25110
        }
    }
}