GET /api/protein/UniProt/Q2J2F0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2J2F0",
        "id": "Q2J2F0_RHOP2",
        "source_organism": {
            "taxId": "316058",
            "scientificName": "Rhodopseudomonas palustris (strain HaA2)",
            "fullName": "Rhodopseudomonas palustris (strain HaA2)"
        },
        "name": "sn-glycerol-3-phosphate transport system permease protein UgpE",
        "description": [
            "Part of the ABC transporter complex UgpBAEC involved in sn-glycerol-3-phosphate (G3P) import. Probably responsible for the translocation of the substrate across the membrane"
        ],
        "length": 282,
        "sequence": "MVEHRRFGNLLPHLILWVGVLIVAFPVYIAFIASTQDNATIANGQMSLLPGGHFLETYYRTLFVGSSGTTREPVGTMLFNSFVMAMLIAVGKIAISLISAYAIVYFRFPFRMTIFWLIFITLMLPVEVRIYPTYKIVADLNLLDSYAGLTLPLIASATATLLFRQFFMTVPDELLEASRIDGAGPFRFFWDTLLPLSRTNMAALFVILFILGWNQYLWPLLITTRDDMQTIQIGIRKMIVTSDALTEWPVVMATAVLAMLPPVAVVVLMQKLFVRGLVETEK",
        "proteome": "UP000008809",
        "gene": "ugpE",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "149ba0064877cb2f3007f9b95b1a3d82ad06c810",
        "counters": {
            "domain_architectures": 894065,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 894065
        }
    }
}