HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2HZ24",
"id": "Q2HZ24_CHLRE",
"source_organism": {
"taxId": "3055",
"scientificName": "Chlamydomonas reinhardtii",
"fullName": "Chlamydomonas reinhardtii"
},
"name": "Ferredoxin",
"description": [
"Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions"
],
"length": 187,
"sequence": "MASMTASLRSSTLASTSAPSAVRPVMGSRARSVRVHASDAFCRDKVSAVRGVESKGISYKVTFVGADGETREISCPDNQYILDAAEAQGLDLPATCRGGICGACVARVAKGTIDPSDIADLTFTLDEEEQAKGMALLCMTRATSDLTLETQSDWGYSLGVGEWKGATGKFSSRPEPTMGKGWAELQK",
"proteome": "UP000006906",
"gene": "FDX3",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051537",
"name": "2 iron, 2 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0022900",
"name": "electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fdc269cf1d8d48c0a366de0336ed1429d1ca6486",
"counters": {
"domain_architectures": 45276,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 45276
}
}
}