General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2GH39",
        "id": "RS5_EHRCR",
        "source_organism": {
            "taxId": "205920",
            "scientificName": "Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)",
            "fullName": "Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)"
        },
        "name": "Small ribosomal subunit protein uS5",
        "description": [
            "With S4 and S12 plays an important role in translational accuracy",
            "Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body"
        ],
        "length": 174,
        "sequence": "MDVVKKSRNVHGSNDFSELIVSVRRVAKVVKGGRRFSFSVLVVIGDEKGKVGCGIGKHLEVSEAKIKAVNAARKNMIRVHLRESRTLHHDVKAKFCSSKVMLRSAKVGTGIIAGGSIRLIFEVLGVQDVVAKSIGSSNPHNVVYAVFAAFRKMLSPKQVANKRSRKIGDIIENR",
        "proteome": "UP000008320",
        "gene": "rpsE",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ddb47877d1b64f864fa25e376c154e201459d42b",
        "counters": {
            "domain_architectures": 34638,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 1,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 34638
        }
    }
}