HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2G341",
"id": "ARGB_NOVAD",
"source_organism": {
"taxId": "279238",
"scientificName": "Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)",
"fullName": "Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)"
},
"name": "Acetylglutamate kinase",
"description": [
"Catalyzes the ATP-dependent phosphorylation of N-acetyl-L-glutamate"
],
"length": 303,
"sequence": "MSQNHDPAMLAKAETLTEALPYLQRYAGKTFVVKYGGHAMGDPELAQDFAEDIVLLKAVGINPVVVHGGGPQIGRMLKALGIESRFVDGLRVTDKQTAEVAEMVLAGAINKELVSWIARAGGKAIGISGKDGGMVIARKVEAKKAPKAVADAESGDPIVVDLGFVGEPDRIDTTVIDTICKAGMIPVIAPIGVGEDGETYNINADTMAGSIAAALGAARLFLLTDVPGVLDKDKNLLTDLRPADIARLAEDGTISGGMIPKLETCVHAVEAGCEATVVLDGRVPHAMLLEIFTARGAGTLIRA",
"proteome": "UP000009134",
"gene": "argB",
"go_terms": [
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003991",
"name": "acetylglutamate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006526",
"name": "L-arginine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b73790bda6cd15191430dc28c4ec048bb434309a",
"counters": {
"domain_architectures": 77738,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 77738
}
}
}