GET /api/protein/UniProt/Q2G341/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2G341",
        "id": "ARGB_NOVAD",
        "source_organism": {
            "taxId": "279238",
            "scientificName": "Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)",
            "fullName": "Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)"
        },
        "name": "Acetylglutamate kinase",
        "description": [
            "Catalyzes the ATP-dependent phosphorylation of N-acetyl-L-glutamate"
        ],
        "length": 303,
        "sequence": "MSQNHDPAMLAKAETLTEALPYLQRYAGKTFVVKYGGHAMGDPELAQDFAEDIVLLKAVGINPVVVHGGGPQIGRMLKALGIESRFVDGLRVTDKQTAEVAEMVLAGAINKELVSWIARAGGKAIGISGKDGGMVIARKVEAKKAPKAVADAESGDPIVVDLGFVGEPDRIDTTVIDTICKAGMIPVIAPIGVGEDGETYNINADTMAGSIAAALGAARLFLLTDVPGVLDKDKNLLTDLRPADIARLAEDGTISGGMIPKLETCVHAVEAGCEATVVLDGRVPHAMLLEIFTARGAGTLIRA",
        "proteome": "UP000009134",
        "gene": "argB",
        "go_terms": [
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003991",
                "name": "acetylglutamate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006526",
                "name": "L-arginine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b73790bda6cd15191430dc28c4ec048bb434309a",
        "counters": {
            "domain_architectures": 77738,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 77738
        }
    }
}