GET /api/protein/UniProt/Q2FXT5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q2FXT5",
        "id": "QUEA_STAA8",
        "source_organism": {
            "taxId": "93061",
            "scientificName": "Staphylococcus aureus (strain NCTC 8325 / PS 47)",
            "fullName": "Staphylococcus aureus (strain NCTC 8325 / PS 47)"
        },
        "name": "S-adenosylmethionine:tRNA ribosyltransferase-isomerase",
        "description": [
            "Transfers and isomerizes the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to give epoxyqueuosine (oQ-tRNA)"
        ],
        "length": 341,
        "sequence": "MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKEETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNFGNGKIIAECIKEMDQGGRIMRLHYEGILQERLDELGEMPLPPYIKERLDDPDRYQTVYAKESGSAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYPGFDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFGDAMLII",
        "proteome": "UP000008816",
        "gene": "queA",
        "go_terms": [
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016853",
                "name": "isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c467c49db6729470d5e4ab82decb19fdedd18505",
        "counters": {
            "domain_architectures": 24343,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24343
        }
    }
}