GET /api/protein/UniProt/Q2FXT5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q2FXT5",
"id": "QUEA_STAA8",
"source_organism": {
"taxId": "93061",
"scientificName": "Staphylococcus aureus (strain NCTC 8325 / PS 47)",
"fullName": "Staphylococcus aureus (strain NCTC 8325 / PS 47)"
},
"name": "S-adenosylmethionine:tRNA ribosyltransferase-isomerase",
"description": [
"Transfers and isomerizes the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to give epoxyqueuosine (oQ-tRNA)"
],
"length": 341,
"sequence": "MNIEEFDYDLPESLIAQTPLKDRDHSRLLVMDRETGEMKHLHFKDIIEYFRPGDTLVLNDTRVMPARLFGLKEETGAKVEMLMLTQIEGNDWEVLLKPAKRIKVGNKLNFGNGKIIAECIKEMDQGGRIMRLHYEGILQERLDELGEMPLPPYIKERLDDPDRYQTVYAKESGSAAAPTAGLHFTDELLIEIKNKGVNIAFVTLHVGLGTFRPVSVDDVNDHEMHSEYYQMTQETADLLNDTKSKGHRIISVGTTSTRTLETIRRDHDKFVETSGWTNIFIYPGFDFKAIDGQITNFHLPKSTLVMLVSAFSSRENVLNAYKTAVNLEYRFFSFGDAMLII",
"proteome": "UP000008816",
"gene": "queA",
"go_terms": [
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016853",
"name": "isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c467c49db6729470d5e4ab82decb19fdedd18505",
"counters": {
"domain_architectures": 24343,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24343
}
}
}