General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q299B0",
        "id": "CORZ_DROPS",
        "source_organism": {
            "taxId": "46245",
            "scientificName": "Drosophila pseudoobscura pseudoobscura",
            "fullName": "Drosophila pseudoobscura pseudoobscura (Fruit fly)"
        },
        "name": "Pro-corazonin",
        "description": [
            "Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. Clock (Clk) and cycle (cyc) proteins negatively regulate Crz transcription in a cell-specific manner (By similarity)"
        ],
        "length": 161,
        "sequence": "MMRLLLLPLFLFTLSMACMGQTFQYSRGWTNGKRALTPPSLLSHGHFNRASDLGFSDLYDVQDWSSERRLERCLAQLQRSLLSRVYGSVVDFNANRPEPDSSDSGSSRNRANNNNENVLYPTPIQNRHHSSNELLEEISAAVAGSGPTGAGSGEPSVFGKH",
        "proteome": "UP000001819",
        "gene": "Crz",
        "go_terms": [
            {
                "identifier": "GO:0071858",
                "name": "corazonin receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045823",
                "name": "positive regulation of heart contraction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f68ceb1fb072ddd6a03e21edb98486cf4d0d996e",
        "counters": {
            "domain_architectures": 261,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 261
        }
    }
}