GET /api/protein/UniProt/Q1ZQM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1ZQM1",
"id": "Q1ZQM1_PHOAS",
"source_organism": {
"taxId": "314292",
"scientificName": "Photobacterium angustum (strain S14 / CCUG 15956)",
"fullName": "Photobacterium angustum (strain S14 / CCUG 15956)"
},
"name": "tRNA 5-carboxymethoxyuridine methyltransferase",
"description": [
"Catalyzes the methylation of 5-carboxymethoxyuridine (cmo5U) to form 5-methoxycarbonylmethoxyuridine (mcmo5U) at position 34 in tRNAs"
],
"length": 277,
"sequence": "MIKDRNFDDLAQKFAENIYGTAKGQIRQTVVWQDIEQILTSLSSVSPLTVLDAGGGIGQLSQKIASLGHQVTLCDLSSEMLTLAQQEIAKNGLLEQYRLVHCPVQEIGEFIPEPVDLILFHAVMEWLAEPIEVLTGLLDNVKPGGAISVMFYNYNGLLFKNLICGNLTHIEQGMPHRKRFKLQPQQGIKPEDVYQCLTDAGFEIMGKTGVRTFHDYIQTHMVGDYSFEQVLEMEQKLCRQEPFLSLGRYIHVYARKPFAEETHITTTNSNNSNKDKG",
"proteome": null,
"gene": "cmoM",
"go_terms": [
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "acfb62ec32a98f53f626420cecc289d2c02361e6",
"counters": {
"domain_architectures": 191063,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 191063
}
}
}