GET /api/protein/UniProt/Q1RCN0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1RCN0",
"id": "ISPE_ECOUT",
"source_organism": {
"taxId": "364106",
"scientificName": "Escherichia coli (strain UTI89 / UPEC)",
"fullName": "Escherichia coli (strain UTI89 / UPEC)"
},
"name": "4-diphosphocytidyl-2-C-methyl-D-erythritol kinase",
"description": [
"Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol"
],
"length": 283,
"sequence": "MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLSTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML",
"proteome": null,
"gene": "ispE",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050515",
"name": "4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016114",
"name": "terpenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a62f51c1969ff024728e0947aa2f8ff7c94bc280",
"counters": {
"domain_architectures": 54244,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 54244
}
}
}