General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q1R9W7",
        "id": "RCNR_ECOUT",
        "source_organism": {
            "taxId": "364106",
            "scientificName": "Escherichia coli (strain UTI89 / UPEC)",
            "fullName": "Escherichia coli (strain UTI89 / UPEC)"
        },
        "name": "Transcriptional repressor RcnR",
        "description": [
            "Repressor of rcnA expression. Acts by binding specifically to the rcnA promoter in the absence of nickel and cobalt. In the presence of one of these metals, it has a weaker affinity for rcnA promoter (By similarity)"
        ],
        "length": 90,
        "sequence": "MSHTIRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTEHIVHQGDELKREEDLDVVLKVLDSYIK",
        "proteome": null,
        "gene": "rcnR",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "380cb4faa29758dccddf3e809349c67eddbc6cfa",
        "counters": {
            "domain_architectures": 26486,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26486
        }
    }
}