GET /api/protein/UniProt/Q1R7B9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q1R7B9",
        "id": "ZAPA_ECOUT",
        "source_organism": {
            "taxId": "364106",
            "scientificName": "Escherichia coli (strain UTI89 / UPEC)",
            "fullName": "Escherichia coli (strain UTI89 / UPEC)"
        },
        "name": "Cell division protein ZapA",
        "description": [
            "Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division"
        ],
        "length": 109,
        "sequence": "MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALNISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE",
        "proteome": null,
        "gene": "zapA",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c53cc3f60b50f86d6eaf925d526da9863fb8c89f",
        "counters": {
            "domain_architectures": 16076,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 16076
        }
    }
}