GET /api/protein/UniProt/Q1LX17/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1LX17",
"id": "Q1LX17_DANRE",
"source_organism": {
"taxId": "7955",
"scientificName": "Danio rerio",
"fullName": "Danio rerio (Zebrafish)"
},
"name": "Cyclin-dependent kinases regulatory subunit",
"description": [
"Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function"
],
"length": 78,
"sequence": "MSSGKKQIYYSDKYSDEEYEYRHVMLPKQLSKLVPSSHLMSEEEWRGLGVQQSQGWIHYMIHKPEPHILLFRRPLPKE",
"proteome": "UP000000437",
"gene": "cks2",
"go_terms": [
{
"identifier": "GO:0016538",
"name": "cyclin-dependent protein serine/threonine kinase regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "573de365b1a9b08c6bf1cae7df2ff815ab46e983",
"counters": {
"domain_architectures": 5923,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5923
}
}
}