GET /api/protein/UniProt/Q1LHJ9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1LHJ9",
"id": "RSMG_CUPMC",
"source_organism": {
"taxId": "266264",
"scientificName": "Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)",
"fullName": "Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)"
},
"name": "Ribosomal RNA small subunit methyltransferase G",
"description": [
"Specifically methylates the N7 position of guanine in position 527 of 16S rRNA"
],
"length": 235,
"sequence": "MGGSRHFAVDDAAQRRRLEAGLDAIGLALTPAQVDTLFAYLTLLRKWNGVYNLTAIRHPDEMLTHHLLDSLTAVPALAEAARSANVAQGARGRVLDVGSGGGMPGMPLAISCPDVSVLMVDIVQKKTAFLTQCRAQLHLTNAAAHWGPVEKIDDEQGYAVITSRAFAELTDFVTLSGHLLAPGGKLIAMKGVYPQAEIDRMEAAGLMADWQVEAVPKLVVPELDVERHLVVLSRR",
"proteome": "UP000002429",
"gene": "rsmG",
"go_terms": [
{
"identifier": "GO:0008649",
"name": "rRNA methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dab470c3cc0611b3efe4c44bfc5a79eb65c34c07",
"counters": {
"domain_architectures": 25728,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25728
}
}
}