GET /api/protein/UniProt/Q1J6U4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q1J6U4",
        "id": "UVRC_STRPF",
        "source_organism": {
            "taxId": "370554",
            "scientificName": "Streptococcus pyogenes serotype M4 (strain MGAS10750)",
            "fullName": "Streptococcus pyogenes serotype M4 (strain MGAS10750)"
        },
        "name": "UvrABC system protein C",
        "description": [
            "The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision"
        ],
        "length": 598,
        "sequence": "MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITRYIKKNDGLYFGPYPDSYTANEVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEELVAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLRIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIEKQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQQITDNKNDRSSP",
        "proteome": null,
        "gene": "uvrC",
        "go_terms": [
            {
                "identifier": "GO:0006289",
                "name": "nucleotide-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009381",
                "name": "excinuclease ABC activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009380",
                "name": "excinuclease repair complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "80bc0f1e58181dabd87bbe5b77e76eaeb8491265",
        "counters": {
            "domain_architectures": 18237,
            "entries": 33,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 4,
                "cdd": 1,
                "profile": 3,
                "smart": 1,
                "ssf": 3,
                "pfam": 6,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 12
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 18237
        }
    }
}