HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1J6U4",
"id": "UVRC_STRPF",
"source_organism": {
"taxId": "370554",
"scientificName": "Streptococcus pyogenes serotype M4 (strain MGAS10750)",
"fullName": "Streptococcus pyogenes serotype M4 (strain MGAS10750)"
},
"name": "UvrABC system protein C",
"description": [
"The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision"
],
"length": 598,
"sequence": "MNELIKHKLELLPDSPGCYLHKDKEGTIIYVGKAKNLKKRVRSYFRGSHDTKTELLVSEIVDFEYIVTESDTEALLLEINLIQKNMPKYNIKLKDDKSYPFLKITNESFPRLVITRYIKKNDGLYFGPYPDSYTANEVKKLLDRIFPFKKCKNPINKVCFYYHLGQCCAHTICHTDKAYWDRLIDDVKHFLNGKDDKIIEDLRSKMLAASEEMAFERAAEYRDLISGIATMRTKQRVMSKDLQDRDIFGYYVDKGWMCVQVFFVRQGKLIQRDVNLFPYYNDAEEDFLTYMGQFYQDKQHFIPKEVFIPEAIDEELVAAIVPTKIIKPKRGEKKQLVALATKNARVSLQQKFDLLEKDIKKTSGAIENLGQLLRIDKPVRIEAFDNSNIQGTSPVAAMVVFVDGKPSKKDYRKFKIKTVVGPDDYASMREVLFRRYSRVKKEGLQAPNLIIVDGGVGQVNVAKDVIEKQLGLTIPVAGLQKNDKHQTHDLLFGNPLEVVPLPRRSEEFFLLHRIQDEVHRFAVTFHRQVRRKNSFSSTLDHISGLGPKRKQLLLRHFKTITAIASATSEEIQALGIPKTVVEAIQQQITDNKNDRSSP",
"proteome": null,
"gene": "uvrC",
"go_terms": [
{
"identifier": "GO:0006289",
"name": "nucleotide-excision repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009381",
"name": "excinuclease ABC activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009380",
"name": "excinuclease repair complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "80bc0f1e58181dabd87bbe5b77e76eaeb8491265",
"counters": {
"domain_architectures": 18237,
"entries": 33,
"isoforms": 0,
"proteomes": 0,
"sets": 5,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 4,
"cdd": 1,
"profile": 3,
"smart": 1,
"ssf": 3,
"pfam": 6,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 12
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 18237
}
}
}