HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1IV81",
"id": "HSLV_KORVE",
"source_organism": {
"taxId": "204669",
"scientificName": "Koribacter versatilis (strain Ellin345)",
"fullName": "Koribacter versatilis (strain Ellin345)"
},
"name": "ATP-dependent protease subunit HslV",
"description": [
"Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery"
],
"length": 180,
"sequence": "MSSKRLVRSTTVLCVRRDGKVVMAADGQVTLGEGVIKHNARKLRRLYQDKIIAGFAGSTADAFSLFGRFESKLEQYHGNLSRAAVELGKDWRTDKMLRQLEALLLVADKDQTFLISGQGDVIEPDTGIAAIGSGGSYATAAATALLEHSTLDARQIAEEAMKIAGKICIYTNDRVTIEEL",
"proteome": "UP000002432",
"gene": "hslV",
"go_terms": [
{
"identifier": "GO:0030163",
"name": "protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005839",
"name": "proteasome core complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004298",
"name": "threonine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009376",
"name": "HslUV protease complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
"counters": {
"domain_architectures": 65712,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 65712
}
}
}