General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q1CLK4",
        "id": "LUXS_YERPN",
        "source_organism": {
            "taxId": "377628",
            "scientificName": "Yersinia pestis bv. Antiqua (strain Nepal516)",
            "fullName": "Yersinia pestis bv. Antiqua (strain Nepal516)"
        },
        "name": "S-ribosylhomocysteine lyase",
        "description": [
            "Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD)"
        ],
        "length": 171,
        "sequence": "MPLLDSFTVDHTIMKAPAVRVAKTMKTPHGDEITVFDLRFCVPNKEVMPEKGIHTLEHLFAGFMRDHLNGDGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVTDQRKIPELNEYQCGTYHMHSLEEAQSIAKDILDRDVRINHNEELALPKEKLTELHI",
        "proteome": null,
        "gene": "luxS",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043768",
                "name": "S-ribosylhomocysteine lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009372",
                "name": "quorum sensing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d416792ee549289affa401b5b604f54b39bb12b3",
        "counters": {
            "domain_architectures": 7897,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7897
        }
    }
}