GET /api/protein/UniProt/Q181N0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q181N0",
"id": "Q181N0_CLOD6",
"source_organism": {
"taxId": "272563",
"scientificName": "Clostridioides difficile (strain 630)",
"fullName": "Clostridioides difficile (strain 630)"
},
"name": "Ascorbate-specific PTS system EIIC component",
"description": [
"The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II UlaABC PTS system is involved in ascorbate transport"
],
"length": 423,
"sequence": "MEFIISLLSTPAVLLGVVACIGLILQKKSAVEVFTGSSKTLIGFLIFGIGASAMTGALQNFNKLFQHGFGITGVIASPEAATALAQGTYGFAVSCTLILGFILNLVFARITKFKNIFFTTGHSLFFSCVLVLIMKAHGFDNTITILIGGTILGFMSAALPQFCQPFMRELTGGDEQAIGHFNMIGYGLSGYIGRLFSKHKDDTTETIEFPKWLSIFRDFLMGLSIVMLILFYIATLKAGQAFTQEIAGSTHWLVFPLIEAFTFVAGMSILMSGVRMFLAEITAAFVIISEKYIPGSRPALDVPTVFPYAPNAVIIGFISAYAAGLLAIAIMASFPSIFPVVIIPAAHICFFSGGTAAIFGNTSGGWRGAIAGSFVVGLLLAFLPVILYPVYGTLGIEGATFPNIDYNVVGSILHNILQFIKPI",
"proteome": null,
"gene": "CD630_36290",
"go_terms": [
{
"identifier": "GO:0009401",
"name": "phosphoenolpyruvate-dependent sugar phosphotransferase system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ce02596cbe50c5a88053d03c63ea950756a35d4",
"counters": {
"domain_architectures": 13263,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13263
}
}
}