GET /api/protein/UniProt/Q17CJ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q17CJ5",
        "id": "SGF11_AEDAE",
        "source_organism": {
            "taxId": "7159",
            "scientificName": "Aedes aegypti",
            "fullName": "Aedes aegypti (Yellowfever mosquito)"
        },
        "name": "SAGA-associated factor 11 homolog",
        "description": [
            "Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription"
        ],
        "length": 180,
        "sequence": "MGENEPIHIEYADETELLTEFRQYMADPDTREKAANYLLDSLVDEMILGVVFEVHHAYKTGSGAAIEGQPEDCKPYTIVDLPDMDVFGSSNSKKAIDCSCPNCNRIVAASRFAPHLEKCMGMGRNSSRIASRRIANTRDGGNYFGADEDDEDDADWSGEKRKKKIAPVRTNGSKKNGKTS",
        "proteome": "UP000008820",
        "gene": "Sgf11",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "36ee558566e637e6a3bbab59028da8ccf0aedd65",
        "counters": {
            "domain_architectures": 636,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 636
        }
    }
}