HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q12M46",
"id": "MSBA_SHEDO",
"source_organism": {
"taxId": "318161",
"scientificName": "Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)",
"fullName": "Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)"
},
"name": "ATP-dependent lipid A-core flippase",
"description": [
"Involved in lipopolysaccharide (LPS) biosynthesis. Translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation"
],
"length": 600,
"sequence": "MTASPKNEMSTVFKRLMTYVMPMKGMLTLSILGLIVYGLVDAAFIAFIKPFIDEGFSQNPTVVAGVELPTSGGFSANKDVMLMAPLVVIGMFTLRGVANFVSTYCISYLSAQLIMDMRQQVFEHYLRLPVSYIDRENSGNLISRVTFDTEQIARASGSALISIVRDSITVIGMLALMFFYSWKLSLCILVIGPLMGVVISIVSKRFRKVSVQIQSAMGGVTATTEQMIKGHKNVLSFGGQETESKRFYEVNDRNRYQNMKLAMAQSVSQPVIMIIGSFALAFVLYAASLDSMKLELTAGTFAAILGAMLAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGAHQVERVQGHLRFDNVSFSYPGQAKPALNNIDFDVKPGKTVALVGRSGSGKSTMASLITRFYTGLEQGDIRLDDVSIYDYSLKSLRSQVALVSQQVTLFNDSIANNIAYAYPGEVSREQILKAATLAHAMEFIEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQLGLDNLRHNRTSIVIAHRLSTIESADEILVIDQGKIIERGTHASLIEKKGAYAGLYQMQFGE",
"proteome": "UP000001982",
"gene": "msbA",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0140359",
"name": "ABC-type transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034040",
"name": "ATPase-coupled lipid transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b8babab8a8a60da480131d7c384e38238b38641e",
"counters": {
"domain_architectures": 249078,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"profile": 2,
"pfam": 2,
"smart": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 249078
}
}
}