HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q104K8",
"id": "Q104K8_LYNLY",
"source_organism": {
"taxId": "13125",
"scientificName": "Lynx lynx",
"fullName": "Lynx lynx (Eurasian lynx)"
},
"name": "Sex-determining region Y protein",
"description": [
"Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. SRY HMG box recognizes DNA by partial intercalation in the minor groove and promotes DNA bending. Also involved in pre-mRNA splicing. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons"
],
"length": 234,
"sequence": "MLRVLSSDEHREAVQQQNILAVEGTSCELCTESPTSNYRCETRGKGRDRGQDRVKRPMNAFMVWSRDQRRKVALENPQTQNSEISKQLGYQWKMLTEAEKWPFFEEAQRLQALHREKYPGYKYRPRRKATPEKSDKLLPADPSTTLCSQLHAGERLYAFPYKDGCTKAAHSRMKDQLYSSSEPMSITSSLLEPGPHRTSTTLQDSPEDLAMQLSADAPLYRNLELGVSEAYFAW",
"proteome": null,
"gene": "SRY",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030238",
"name": "male sex determination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ba71805ac3750d134530e8b8d14e816f9d4dbece",
"counters": {
"domain_architectures": 54587,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 54587
}
}
}