HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q0ZA50",
"id": "HBA_PANHO",
"source_organism": {
"taxId": "59538",
"scientificName": "Pantholops hodgsonii",
"fullName": "Pantholops hodgsonii (Chiru)"
},
"name": "Hemoglobin subunit alpha",
"description": [
"Involved in oxygen transport from the lung to the various peripheral tissues",
"Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1. Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling"
],
"length": 142,
"sequence": "MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHLPNDFTPAVHASLDKFLASVGTVLTSKYR",
"proteome": null,
"gene": "HBA",
"go_terms": [
{
"identifier": "GO:0019825",
"name": "oxygen binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015671",
"name": "oxygen transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005833",
"name": "hemoglobin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "479f10f36c30dd70c041c861502b6b89292a259d",
"counters": {
"domain_architectures": 26315,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26315
}
}
}