General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0VFA5",
        "id": "Q0VFA5_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Syntaxin-8",
        "description": [
            "Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER"
        ],
        "length": 235,
        "sequence": "PDPWLATYDDTYQLAQEIAEKLHERNRYLRNGENPVKINVALRSLMQNLSGKIGQLKESLLRSVSTRQITQLEGDRRQNLVDELLTKERQLQTSFQREGAEPDLVRSSLMAGGARSSSRNNPWVLEEPEETRGFTFQEIKQQQHQIIREQDAGLDALSSILARQKQMGQDIGNELDEQNEIIDDVSALVDTTDSKIRNQTRHIKLVDGKSGSCAMMVVIVLLLVAIVVVAVWPTH",
        "proteome": null,
        "gene": "LOC496624",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}