GET /api/protein/UniProt/Q0V6H9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q0V6H9",
"id": "Q0V6H9_PHANO",
"source_organism": {
"taxId": "321614",
"scientificName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)",
"fullName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus)"
},
"name": "SUI1 domain-containing protein",
"description": [
"Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation"
],
"length": 141,
"sequence": "MSDQIASHGVQWELLVDSGYMLSRGPHLKRAGNSSRMSIENLKTFDPFAEADEDTGQVKQSQQDYIHIRIQLQGLPKKFDQKKILKVIKKKFACNGTIVTDVEMGEVVQLQGDQRKDVQDFLTDKKEGLGLDTKTIKVHGF",
"proteome": null,
"gene": "SNOG_00385",
"go_terms": [
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1c85f241b778189fd9a754044a87eb621166ad3c",
"counters": {
"domain_architectures": 16386,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 16386
}
}
}