GET /api/protein/UniProt/Q0V6H9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0V6H9",
        "id": "Q0V6H9_PHANO",
        "source_organism": {
            "taxId": "321614",
            "scientificName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)",
            "fullName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus)"
        },
        "name": "SUI1 domain-containing protein",
        "description": [
            "Additional factor that functions in concert with eIF-2 and the initiator tRNA in directing the ribosome to the proper start site of translation"
        ],
        "length": 141,
        "sequence": "MSDQIASHGVQWELLVDSGYMLSRGPHLKRAGNSSRMSIENLKTFDPFAEADEDTGQVKQSQQDYIHIRIQLQGLPKKFDQKKILKVIKKKFACNGTIVTDVEMGEVVQLQGDQRKDVQDFLTDKKEGLGLDTKTIKVHGF",
        "proteome": null,
        "gene": "SNOG_00385",
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1c85f241b778189fd9a754044a87eb621166ad3c",
        "counters": {
            "domain_architectures": 16386,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 16386
        }
    }
}