General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0T147",
        "id": "Q0T147_SHIF8",
        "source_organism": {
            "taxId": "373384",
            "scientificName": "Shigella flexneri serotype 5b (strain 8401)",
            "fullName": "Shigella flexneri serotype 5b (strain 8401)"
        },
        "name": "Membrane-bound lytic murein transglycosylase A",
        "description": [
            "Murein-degrading enzyme. May play a role in recycling of muropeptides during cell elongation and/or cell division. Degrades murein glycan strands and insoluble, high-molecular weight murein sacculi"
        ],
        "length": 365,
        "sequence": "MKGRWVKYLLMGTVVAMLAACSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALGDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAPGAGNVFSG",
        "proteome": null,
        "gene": "mltA",
        "go_terms": [
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009254",
                "name": "peptidoglycan turnover",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019867",
                "name": "outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d2abb7cd51cfb49c2425fc66c4537cf5157c8cb3",
        "counters": {
            "domain_architectures": 8229,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "smart": 1,
                "cdd": 2,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8229
        }
    }
}