HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q0SGP6",
"id": "ATPD_RHOJR",
"source_organism": {
"taxId": "101510",
"scientificName": "Rhodococcus jostii (strain RHA1)",
"fullName": "Rhodococcus jostii (strain RHA1)"
},
"name": "ATP synthase subunit delta",
"description": [
"F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation",
"This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction"
],
"length": 275,
"sequence": "MYAASREALTQTRAALSSALGSVSAGAATAAAAQIGAELFSVVEILDEQRTLRSALSDTSTPGNVREGLAEQVFGGKVSAETLAVLKAAVGQDWSVTSDLLNSLVLVGRESLLKAAADQGQLDAVEDELFRLGRIVAGNPKLEQSLSDRSVPAKRKRELLSKLLYGKVTAVAEALATQAVGRLKNSAPADAFDELSNLAAAQREAVVAKVRSSAPLSSEQSDRLTATLTRTYGKPVTVHVEVDPELLSGLVVRVGDEVIDGSGAGRLAALRKSLK",
"proteome": null,
"gene": "atpH",
"go_terms": [
{
"identifier": "GO:0046933",
"name": "proton-transporting ATP synthase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "84bdeca744b3566e5527e453190da923dfa0eb71",
"counters": {
"domain_architectures": 30348,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"ncbifam": 2,
"hamap": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30348
}
}
}